TB500 5mg

(19 customer reviews)

£29.95
You save

Buy the best Quality Growth Hormone Releasing Peptide TB500 5mg in the UK.

Quantity Discount (%) Price
1 - 4 £29.95
5 - 9 3.17 % £29.00
10 - 24 6.51 % £28.00
25+ 9.85 % £27.00
Purchase this product now and earn 300 Points!
Our TB500 5mg is strictly manufactured in a fully certified laboratory that is cGMP and IS09001 compliant. This research product is for sale for the strict use in in-vitro research only. At PeptidesUK you are always guaranteed a purity of >98% from all our listed peptides.
Our peptide vials are safely stored in a fully monitored and temperature controlled system which maintains high-quality and purity. TB500 (Thymosin Beta 4) is also strictly tested for purity by HPLC and MS-UPLC analysis. You can always contact us for discounts on bulk orders. Safely shipped from the UK via fast and reliable shipping services.
  • Peptide Name: TB500 5mg
  • Molecular Formula: C212/H350/N56/O78/S
  • Molecular Weight: 4963.4 g/mol
  • Purity: 98%
  • Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
  • Form: Lyophilised Solid

TB-500, available in a 5mg formulation, stands as a top-quality, specialized research peptide meticulously crafted for cutting-edge scientific investigation into cellular rejuvenation and tissue restoration.

TB500 Storage and Usage

TB500 comes in lyophilized form for optimal stability and convenient use in research settings.

For optimal outcomes, adhere to the comprehensive reconstitution instructions and storage instructions provided on our website.

Peptides UK Products are sold strictly for research purposes only. Please do not ask about human consumption as this is forbidden

  • Product Name: Thymosin Beta 4
  • Molecular Formula: C212/H350/N56/O78S
  • Molecular Weight:
  • Purity: >98%
  • Sequence: Ac-Ser-Asp-Lys-Pro-Asp-Met-Ala-Glu-Ile-Glu-Lys-Phe-Asp-Lys-Ser-Lys-Leu-Lys-Lys-Thr-Glu-Thr-Gln-Glu-Lys-Asn-Pro-Leu-Pro-Ser-Lys-Glu-Thr- Ile-Glu-Gln-Glu-Lys-Gln-Ala-Gly-Glu-Ser-OH
  • Form: Lyophilised Solid

 

PHYSICAL AND CHEMICAL PROPERTIES

Thymosin Beta 4 (TB500)
5mg per vial

Product Name: Thymosin Beta 4

Unit Size: 5mg per vial

CAS No: 77591-33-4

Synomyms: TB 500

Sequence: Ac-Ser-Asp-Lys-Pro-Asp-Met-Ala-Glu-Ile-Glu-Lys-Phe-Asp-Lys-Ser-Lys-Leu-Lys-Lys-Thr-Glu-Thr-Gln-Glu-Lys-Asn-Pro-Leu-Pro-Ser-Lys-Glu-Thr- Ile-Glu-Gln-Glu-Lys-Gln-Ala-Gly-Glu-Ser-OH

Molecular Formula: C212/H350/N56/O78/S

Purity: >98%

Physical State: Lyophilized Powder

Storage: Although lyophilized peptides are stable at room temperature for up to 2 months, they should be stored desiccated below -18°C. On reconstitution, the peptide should then be stored at 4°C

19 reviews for TB500 5mg

  1. Lex (verified owner)

    I have ordered from here for years. A trusted company that always backs up their products and acts quickly to help or fix any issues. A+++

  2. Robert W. (verified owner)

    Very happy.no problems with delivery would recommend to others to use this company.

  3. Alan Evans (verified owner)

  4. Mike (verified owner)

    Good quality product everytime

  5. Anonymous (verified owner)

    Goes hand in hand with BPC 157.

  6. Anonymous (verified owner)

  7. Anonymous (verified owner)

    Great products

  8. Yonatan Harel (verified owner)

    It’s always hard to judge with an N=1 experiment, but I do think this helped.

  9. Darren Cook (verified owner)

    Very happy

  10. Steve D. (verified owner)

    A+

  11. Aleksandr (verified owner)

    Very good

  12. Anonymous (verified owner)

  13. Brian (verified owner)

    Good quality product at a great price and quick delivery

  14. Alex (verified owner)

    Always extremely happy with the product and service

  15. Steve (verified owner)

    5*

  16. Anonymous (verified owner)

  17. Anonymous (verified owner)

  18. Anonymous (verified owner)

    Good product

  19. Alex S. (verified owner)

    great with bpc157

Add a review

Your email address will not be published. Required fields are marked *

All products listed and provided through PeptidesUK are intended for research purposes only. We do not promote the personal use of these products.

Products provided by PeptidesUK are not intended for use in food products or as any type of drug.

Our products are not intended to treat, prevent, mitigate or cure any disease or medical condition and are for research purposes only.