IGF-1 LR3 1mg

(3 customer reviews)

£49.95
You save

Buy the best Quality IGF-1 LR3 1mg in the UK.

Quantity Discount (%) Price
1 - 4 £49.95
5 - 9 5.91 % £47.00
10+ 9.91 % £45.00
Purchase this product now and earn 500 Points!

Buy 95% purity IGF-1 LR3 peptide online today at Peptides UK. All peptides provided by Peptides UK are intended for research purposes only. We offer UK and worldwide fast and reliable shipping services. Our peptides are manufactured at a cGMP and ISO9001 compliant and certified laboratory. Our IGF-1 peptide product is the highest grade and quality on the market today. All peptides are sold for research and in vitro studies only. To avoid contamination, degradation, and oxidation, the peptide must be stored correctly in controlled conditions. Once you have received your peptides, they are stable at room temperature for up to 2 months once not reconstituted, but it is recommended that they are stored in refrigeration.

Peptides UK is a truly unique peptide online store offering high quality and high purity peptides, setting a new standard in the industry. All our products are tested for purity by MS-U PLC and HPLC. We offer the most competitive prices on the market for premium quality peptides. We offer combo packages at discounted prices which are created to suit all your research needs.

  • Product Name: IGF LR3 1mg
  • Molecular Weight: 9117.60 gmol
  • Purity: ≥98%
  • Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
  • Form: Lyophilised Solid

Long arginine 3-IGF-1 (IGF-1 LR3), available in a 1mg quantity, is a premium research peptide designed for advanced scientific studies in biochemistry and related disciplines. This product is perfect for laboratory environments that require high levels of precision and reliability.

IGF-1 LR3 Storage and Usage

IGF-1 LR3 1mg comes in lyophilized form for optimal stability and convenient use in research settings.

For optimal outcomes, please adhere to the comprehensive reconstitution instructions and storage instructions provided on our website.

Peptides UK Products are sold strictly for research purposes only. Please do not ask about human consumption as this is forbidden

PHYSICAL AND CHEMICAL PROPERTIES

IGF-1 Long R3 (Insulin-like Growth Factor 1)
1mg per vial

Product Name: IGF-1 LR3

Unit Size: 1mg per vial

CAS No: 946870-92-4

Synomyms: Long R3 IGF-1, Insulin-Like Growth Factor-I LR3

Sequence: H-Met-Phe-Pro-Ala-Met-Pro-Leu-Ser-Ser-Leu-Phe-Val-Asn-Gly-Pro-Arg-Thr-Leu-Cys-Gly-Ala-Glu-Leu-Val-Asp-Ala-Leu-Gln-Phe-Val-Cys-Gly-Asp-Arg-Gly-Phe-Tyr-Phe-Asn-Lys-Pro-Thr-Gly-Tyr-Gly-Ser-Ser-Ser-Arg-Arg-Ala-Pro-Gln-Thr-Gly-Ile-Val-Asp-Glu-Cys-Cys-Phe-Arg-S

Molecular Formula: C990/H1528/N262/O300/S7

Purity: >95%

Physical State: Lyophilized Powder

Storage: Although lyophilized peptides are stable at room temperature for up to 2 months, they should be stored desiccated below -18°C. On reconstitution, the peptide should then be stored at 4°C

3 reviews for IGF-1 LR3 1mg

  1. Nathan (verified owner)

    Very good stuff

  2. Alan Evans (verified owner)

  3. Nathan Ledger (verified owner)

Add a review

Your email address will not be published. Required fields are marked *

All products listed and provided through PeptidesUK are intended for research purposes only. We do not promote the personal use of these products.

Products provided by PeptidesUK are not intended for use in food products or as any type of drug.

Our products are not intended to treat, prevent, mitigate or cure any disease or medical condition and are for research purposes only.